PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn320331
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family HB-other
Protein Properties Length: 444aa    MW: 49863.3 Da    PI: 6.4303
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn320331genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox38.61.8e-1215531856
                HHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox 18 lFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                +Fe  ++p++++r +L ++lgLt +q+k+WFqN+R+  k
  Achn320331 15 YFEGYQHPNERQRCQLGRELGLTPTQIKFWFQNKRTVVK 53
                7999*******************************8666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003890.0039859IPR001356Homeobox domain
CDDcd000869.63E-101554No hitNo description
Gene3DG3DSA:1.10.10.606.0E-111549IPR009057Homeodomain-like
SuperFamilySSF466896.53E-111560IPR009057Homeodomain-like
PROSITE profilePS5007112.5191555IPR001356Homeobox domain
PfamPF000466.2E-101553IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
MLNIALRDLL ADLLYFEGYQ HPNERQRCQL GRELGLTPTQ IKFWFQNKRT VVKKFIFTWY  60
VQAQKERIEG STLREENERF KFENLVMREM LKGELCTPCK DILFSKEERQ WILEQLRMEN  120
AQLHEKYEEL ILGKMGILVS KVPSLPPAPG SSLDAATGSL LGQRIGGLSL DHDLGSRKFI  180
PSTLLYQLKK EQESEKLQMF QTVVNAIDEL TSLMVTETLW IKDPTDGRYI IHRDNYEKTF  240
PRISHLKGSH ARLESSKAEG ILSELNSSGI SVSMFNSMGQ GQPQGLIVNA TISLWLPHPY  300
QVVFDFMRDE KLRYQPLIAC ENNNMLVLQE SCIDPLGAII TYAPITIKCL DMALSGADSS  360
TIPILPSGFI ISSDGHPDTR ARASSSTTRP IAGGSLLTVV YQIPTRNASS SRQVDIELVA  420
SIKELVNSTV QDIWSALHCG GID*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.11e-33homeodomain GLABROUS 11